| 产品详情 |
| Edit |   |
|---|
| Product Name | TAF1L, Recombinant, Human, aa1517-1649, GST-tag |
|---|
| Description | Highly Purified (~99%). This locus is intronless, and apparently arose in the primate lineage from retrotransposition of the transcript from the multi-exon TAF1 locus on the X chromosome. The gene is expressed in male germ cells, and the product has been shown to function interchangeably with the TAF1 product. [provided by RefSeq, Aug 2009]. Source: Recombinant protein corresponding to aa1517-1649 from human TAF1L, fused to GST-tag at N-terminal, expressed in E. coli. Molecular Weight: ~42.3kD AA Sequence: MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYI DGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLK VDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLV CFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLEVLFQGPLGSLLDDD DQVAFSFILDNIVTQKMMAVPDSWPFHHPVNKKFVPDYYKMIVNPVDLETIRKNISKHK YQSRESFLDDVNLILANSVKYNGPESQYTKTAQEIVNICYQTITEYDEHLTQLEKDICTA KEAALEEAE Applications: Suitable for use in the study of bromodomain binding assays, screening inhibitors, and selectivity prof |
|---|
| Size | 100ug |
|---|
| Concentration | n/a |
|---|
| Applications | n/a |
|---|
| Other Names | TAF1L, Recombinant, Human, aa1517-1649, GST-tag (TAF1 RNA Polymerase II, TAT Box Binding Protein (TBP)-Associated Factor) |
|---|
| Gene, Accession, CAS # | Accession: NM_153809, SwissProt: Q8IZX4 |
|---|
| Catalog # | 298478 |
|---|
| Price | |
|---|
| Order / More Info | TAF1L, Recombinant, Human, aa1517-1649, GST-tag from UNITED STATES BIOLOGICAL |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|