| 产品详情 |
| Edit |   |
|---|
| Product Name | ZMYND11, Recombinant, Human, aa150-270, GST-tag |
|---|
| Description | Purified (~80%). The protein encoded by this gene was first identified by its ability to bind the adenovirus E1A protein. The protein localizes to the nucleus. It functions as a transcriptional repressor, and expression of E1A inhibits this repression. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Jul 2008]. Source: Recombinant protein corresponding to aa150-270 from human bromodomain ZMYND11, fused to GST-tag at N-terminal, expressed in E. coli. Molecular Weight: ~41kD AA Sequence: MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYID GDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDF LSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKK RIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLEVLFQGPLGSKKNTNKQEM GTYLRFIVSRMKERAIDLNKKGKDNKHPMYRRLVHSAVDVPTIQEKVNEGKYRSYEEFK ADAQLLLHNTVIFYGADSEQADIARMLYKDTCHELDELQLCKNCFYLSNARPD Applications: Suitable for use in the study of bromodomain binding assays, screening in |
|---|
| Size | 100ug |
|---|
| Concentration | n/a |
|---|
| Applications | n/a |
|---|
| Other Names | ZMYND11, Recombinant, Human, aa150-270, GST-tag (Zinc Finger MYND-Type Containing 11, BRAM1, BS69) |
|---|
| Gene, Accession, CAS # | Accession: NM_006624, SwissProt: Q15326 |
|---|
| Catalog # | 298495 |
|---|
| Price | |
|---|
| Order / More Info | ZMYND11, Recombinant, Human, aa150-270, GST-tag from UNITED STATES BIOLOGICAL |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|