| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | MOGAT1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The MOGAT1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to MOGAT1. This antibody reacts with human. The MOGAT1 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human MOGAT1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: PIPVRQTLNPTQEQIEELHQTYMEELRKLFEEHKGKYGIPEHETLV |
|---|
| Other Names | Acyl-CoA:monoacylglycerol acyltransferase 1, DC2, DGAT2L, Diacylglycerol acyltransferase 2-like protein 1, diacylglycerol O-acyltransferase 2 like 1,2-acylglycerol O-acyltransferase 1, Diacylglycerol O-acyltransferase candidate 2, EC 2.3.1, EC 2.3.1.22, MGAT1hDC2, monoacylglycerol O-acyltransferase 1DGAT2L1 |
|---|
| Gene, Accession # | MOGAT1, Gene ID: 116255 |
|---|
| Catalog # | NBP2-14245 |
|---|
| Price | |
|---|
| Order / More Info | MOGAT1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|