| Edit |   |
| Antigenic Specificity | DEC-205/CD205 |
| Clone | 3G4 |
| Host Species | Mouse |
| Reactive Species | human |
| Isotype | IgG2b kappa |
| Format | IgG purified, no preservative |
| Size | 0.1 mg |
| Concentration | n/a |
| Applications | ELISA. Antibody reactivity against recombinant protein on ELISA. GST alone used as a negative control. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The DEC-205/CD205 Antibody (3G4) from Novus Biologicals is a mouse monoclonal antibody to DEC-205/CD205. This antibody reacts with human. The DEC-205/CD205 Antibody (3G4) has been validated for the following applications: ELISA. |
| Immunogen | LY75 (NP_002340, 37 a.a. - 135 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. TIVHGNTGKCIKPVYGWIVADDCDETEDKLWKWVSQHRLFHLHSQKCLGLDITKSVNELRMFSCDSSAMLWWKCEHHSLYGAARYRLALKDGHGTAIS* |
| Other Names | n/a |
| Gene, Accession # | LY75, Accession: NP_002340, SwissProt: NP_002340 |
| Catalog # | H00004065-M10 |
| Price | |
| Order / More Info | DEC-205/CD205 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |