| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | NARFL |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. WB reported in scientific literature (PMID: 25012650). For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The NARFL Antibody from Novus Biologicals is a rabbit polyclonal antibody to NARFL. This antibody reacts with human. The NARFL Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human NARFL antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: KLEASRPDFFNQEHQTRDVDCVLTTGEVFRLLEEEGVSLPDLEPAPLDSLCSGASAEEPTSHRGGGSGGYLEHVFRHAARELFGIHVAEVTYKP |
|---|
| Other Names | cytosolic Fe-S cluster assembly factor NARFL, FLJ21988, HPRN, IOP1Protein related to Narf, Iron-only hydrogenase-like protein 1, LET1 like/JFP15, nuclear prelamin A recognition factor-like, Nuclear prelamin A recognition factor-like protein, PRNLET1L |
|---|
| Gene, Accession # | NARFL, Gene ID: 64428 |
|---|
| Catalog # | NBP1-83611 |
|---|
| Price | |
|---|
| Order / More Info | NARFL Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 25012650 |
|---|
| 产品资料 |
|
|