| 产品详情 |
| Edit |   |
| Antigenic Specificity | NARG1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot, Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The NARG1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to NARG1. This antibody reacts with human. The NARG1 Antibody has been validated for the following applications: Western Blot, Immunocytochemistry/Immunofluorescence. Specificity of human NARG1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: RTVLKQEMNRLFGATNPKNFNETFLKRNSDSLPHRLSAAKMVYYLDPSSQKRAIELATTLDESLTNRNLQTCMEVLEALYDGSLGDCKEAAEIYRANCHKLFPYALAFMPPGYEEDMKITVN |
| Other Names | FLJ13340, GA19, Gastric cancer antigen Ga19, N(alpha)-acetyltransferase 15, NatA auxiliary subunit, NARG1, NATHGa19, NMDA receptor-regulated protein 1, N-terminal acetyltransferase, Protein tubedown-1, Tbdn100, TBDN100NatA auxiliary subunit, transcriptional coactivator tubedown-100, tubedown-1 |
| Gene, Accession # | NAA15, Gene ID: 80155 |
| Catalog # | NBP2-58078 |
| Price | |
| Order / More Info | NARG1 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|