| 产品详情 |
| Edit |   |
|---|
| Product Name | CDY1, Recombinant, Human, aa2-90, GST-tag |
|---|
| Description | Purified (~73%). Chromodomain proteins are components of heterochromatin-like complexes and can act as gene repressors. CDY1 contains a chromodomain and a histone acetyltransferase catalytic domain. CDY1 has histone acetyltransferase activity, with a preference for histone H4. This protein is localized to the nucleus of late spermatids where histone hyperacetylation takes place. Histone hyperacetylation is thought to facilitate the transition in which protamines replace histones as the major DNA-packaging protein. Source: Recombinant protein corresponding to aa2-90 from human chromodomain protein Y-linked 1, fused to GST-tag at N-terminal, expressed in E. coli. Molecular Weight: ~37.6kD AA Sequence: MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYI DGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLK VDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLV CFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLEVLFQGPLGSASQEF EVEAIVDKRQDKNGNTQYLVRWKGYDKQDDTWEPEQHLMNCEKCVHDFNRR |
|---|
| Size | 100ug |
|---|
| Concentration | n/a |
|---|
| Applications | n/a |
|---|
| Other Names | CDY1, Recombinant, Human, aa2-90, GST-tag (Chromodomain Protein Y-Linked 1, CDY, Testis-Specific Chromodomain Protein Y1) |
|---|
| Gene, Accession, CAS # | Accession: NM_170723, SwissProt: Q9Y6F8 |
|---|
| Catalog # | 298396 |
|---|
| Price | |
|---|
| Order / More Info | CDY1, Recombinant, Human, aa2-90, GST-tag from UNITED STATES BIOLOGICAL |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|