| 产品详情 |
| Edit |   |
|---|
| Product Name | CHD2, Recombinant, Human, aa260-456, GST-tag (Chromodomain Helicase DNA Binding Protein 2) |
|---|
| Description | Purified (~82%). The CHD family of proteins is characterized by the presence of chromo (chromatin organization modifier) domains and SNF2-related helicase/ATPase domains. CHD genes alter gene expression possibly by modification of chromatin structure thus altering access of the transcriptional apparatus to its chromosomal DNA template. Source: Recombinant protein corresponding to aa260-456 from human CHD2, fused to GST-tag at N-terminal, expressed in E. coli. Molecular Weight: ~49.3kD AA Sequence: MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYI DGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLK VDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLV CFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLEVLFQGPLGSSETIE KVLDSRLGKKGATGASTTVYAIEANGDPSGDFDTEKDEGEIQYLIKWKGWSYIHSTW ESEESLQQQKVKGLKKLENFKKKEDEIKQWLGKVSPEDVEYFNCQQELASELNKQY QIVERVIAVKTSKSTLGQTDFPAHSRKPAPSNEPEYLCKWMGLPYSECSWEDEALIG KKFQNCIDSFHSRNNSKTIPTR Applications: Suitable for use in protein binding assays, scr |
|---|
| Size | 100ug |
|---|
| Concentration | n/a |
|---|
| Applications | n/a |
|---|
| Other Names | n/a |
|---|
| Gene, Accession, CAS # | Accession: NM_001271, SwissProt: O14647 |
|---|
| Catalog # | 298401 |
|---|
| Price | |
|---|
| Order / More Info | CHD2, Recombinant, Human, aa260-456, GST-tag (Chromodomain Helicase DNA Binding Protein 2) from UNITED STATES BIOLOGICAL |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|