| 产品详情 |
| Edit |   |
|---|
| Product Name | Tim-3, Recombinant, Human |
|---|
| Description | Purity ~90%. Human secreted TIM-3, Fc fusion protein, also known as T-cell immunoglobulin mucin receptor 3, T-cell membrane protein 3, T-cell and immunoglobulin and mucin domain-containing protein 3, TIMD-3, Hepatitis A virus cellular receptor 2, and HAVCR-2. Source: Recombinant protein corresponding to aa22-200 from human TIM-3, expressed in HEK293 cell expression system. Molecular Weight: ~46.5kD AA Sequence: SEVEYRAEVGQNAYLPCFYTPAAPGNLVPVCWGKGACPVFECGNVVLRTDERDVNY WTSRYWLNGDFRKGDVSLTIENVTLADSGIYCCRIQIPGIMNDEKFNLKLVIKPAKVTP APTRQRDFTAAFPRMLTTRGHGPAETQTLGSLPDINLTQISTLANELRDSRLANDLRD SGATIRIEGRMDPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVV VDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYK CKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVE WESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHY TQKSLSLSPGK Endotoxin: ≤0.1EU/ug Applications: Suitable for use in studying protein binding and screening small molecules. |
|---|
| Size | 100ug |
|---|
| Concentration | n/a |
|---|
| Applications | n/a |
|---|
| Other Names | Tim-3, Recombinant, Human (T-cell Immunoglobulin Mucin Receptor 3, T-cell Membrane Protein 3, T-cell and Immunoglobulin and Mucin Domain-containing Protein 3, TIMD-3, Hepatitis A Virus Cellular Receptor 2, HAVCR-2) |
|---|
| Gene, Accession, CAS # | Accession: NM_032782.4 |
|---|
| Catalog # | 172357 |
|---|
| Price | |
|---|
| Order / More Info | Tim-3, Recombinant, Human from UNITED STATES BIOLOGICAL |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|