| 产品详情 |
| Edit |   |
|---|
| Product Name | Hop, Recombinant, Human, aa2-543, FLAG-tag |
|---|
| Description | Highly Purified (~90%). STIP1 is an adaptor protein that coordinates the functions of HSP70 (see HSPA1A; MIM 140550) and HSP90 (see HSP90AA1; MIM 140571) in protein folding. It is thought to assist in the transfer of proteins from HSP70 to HSP90 by binding both HSP90 and substrate-bound HSP70. STIP1 also stimulates the ATPase activity of HSP70 and inhibits the ATPase activity of HSP90, suggesting that it regulates both the conformations and ATPase cycles of these chaperones (Song and Masison, 2005 [PubMed 16100115]).[supplied by OMIM, Jul 2009]. Source: Recombinant protein corresponding to aa2-543 from full length human Stress-Induced Phosphoprotein 1, fused to FLAG-tag at N-terminal, expressed in E. coli. Molecular Weight: ~64kD AA Sequence: MDYKDDDDKEQVNELKEKGNKALSVGNIDDALQCYSEAIKLDPHNHVLYSNRSAAYAKK GDYQKAYEDGCKTVDLKPDWGKGYSRKAAALEFLNRFEEAKRTYEEGLKHEANNPQLK EGLQNMEARLAERKFMNPFNMPNLYQKLESDPRTRTLLSDPTYRELIEQLRNKPSDLGT KLQDPRIMTTLSVLLGVDLGSMDEEEEIATPPPPPPPKKETKPEPMEEDLPENKKQALKE KELGNDA |
|---|
| Size | 100ug |
|---|
| Concentration | n/a |
|---|
| Applications | n/a |
|---|
| Other Names | Hop, Recombinant, Human, aa2-543, FLAG-tag (STIP1, Stress-Induced Phosphoprotein 1, Hsp70/Hsp90-Organizing Protein, HOP) |
|---|
| Gene, Accession, CAS # | Accession: NM_006819, SwissProt: P31948 |
|---|
| Catalog # | 298412 |
|---|
| Price | |
|---|
| Order / More Info | Hop, Recombinant, Human, aa2-543, FLAG-tag from UNITED STATES BIOLOGICAL |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|