| Edit |   |
|---|
| Antigenic Specificity | Interleukin 21 Receptor |
|---|
| Clone | polyclonal |
|---|
| Host Species | Goat |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunoaffinity purified |
|---|
| Size | 50ug |
|---|
| Concentration | n/a |
|---|
| Applications | ELISA IHC |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Peptide sequence is <50% identical to other sequences in geneban. Recognizes human IL-21 receptor. Not tested for cross reactivity to mouse IL21 receptor. |
|---|
| Immunogen | Synthetic peptide CILEMWNLHPSTLTLTWQDQYEELKDEATS corresponding to 35-65 residues of N-terminus of human IL-21 receptor. |
|---|
| Other Names | Interleukin 21 Receptor (IL-21) |
|---|
| Gene, Accession # | n/a |
|---|
| Catalog # | I8442-24 |
|---|
| Price | |
|---|
| Order / More Info | Interleukin 21 Receptor Antibody from UNITED STATES BIOLOGICAL |
|---|
| Product Specific References | n/a |
|---|