| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | ATP2A1 |
|---|
| Clone | n/a |
|---|
| Host Species | n/a |
|---|
| Reactive Species | mouse, rat predicted to work with: human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot (WB), Immunohistochemistry (IHC) Paraffin |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Anti-ATP2A1 Antibody |
|---|
| Immunogen | A synthetic peptide corresponding to a sequence at the N-terminus of human ATP2A1 (1-32aa MEAAHAKTTEECLAYFGVSETTGLTPDQVKRN), different from the related mouse and rat sequences by three amino acids.Ig Type: Rabbit IgG |
|---|
| Other Names | sarcoplasmic/endoplasmic reticulum calcium ATPase 1 isoform c; Sarcoplasmic/endoplasmic reticulum calcium ATPase 1; sarcoplasmic/endoplasmic reticulum calcium ATPase 1; ATPase sarcoplasmic/endoplasmic reticulum Ca2+ transporting 1; Calcium pump 1; Calcium-transporting ATPase sarcoplasmic reticulum type, fast twitch skeletal muscle isoform; Endoplasmic reticulum class 1/2 Ca(2+) ATPase, ATP2A1; ATP2A1; ATP2A; SERCA1; SERCA1; SR Ca(2+)-ATPase 1 |
|---|
| Gene, Accession # | ATP2A1, Gene ID: 487, NCBI: NP_001273004.1, UniProt: O14983 |
|---|
| Catalog # | MBS177760 |
|---|
| Price | |
|---|
| Order / More Info | ATP2A1 Antibody from MYBIOSOURCE INC. |
|---|
| Product Specific References | 1. Brandl, C. J., Green, N. M., Korczak, B., MacLennan, D. H. Two Ca(2 ) ATPase genes: homologies and mechanistic implications of deduced amino acid sequences. Cell 44: 597-607, 1986. 2. Karpati, G., Charuk, J., Carpenter, S., Jablecki, C., Holland, P. Myopathy caused by a deficiency of Ca(2 )-adenosine triphosphatase in sarcoplasmic reticulum (Brody's disease). Ann. Neurol. 20: 38-49, 1986. 3. Zhang, Y., Fujii, J., Phillips, M. S., Chen, H.-S., Karpati, G., Yee, W.-C., Schrank, B., Cornblath, D |
|---|
| 产品资料 |
|
|