| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | ATP2A2 |
|---|
| Clone | n/a |
|---|
| Host Species | n/a |
|---|
| Reactive Species | mouse, rat predicted to work with: human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot (WB), Immunohistochemistry (IHC) Paraffin |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Anti-ATP2A2 Antibody |
|---|
| Immunogen | A synthetic peptide corresponding to a sequence at the N-terminus of human ATP2A2(1-32aa MENAHTKTVEEVLGHFGVNESTGLSLEQVKKL), identical to the related mouse and rat sequences.Ig Type: Rabbit IgG |
|---|
| Other Names | sarcoplasmic/endoplasmic reticulum calcium ATPase 2 isoform a; Sarcoplasmic/endoplasmic reticulum calcium ATPase 2; sarcoplasmic/endoplasmic reticulum calcium ATPase 2; ATPase sarcoplasmic/endoplasmic reticulum Ca2+ transporting 2; Calcium pump 2; Calcium-transporting ATPase sarcoplasmic reticulum type, slow twitch skeletal muscle isoform; Endoplasmic reticulum class 1/2 Ca(2+) ATPase, ATP2A2; ATP2A2; DD; DAR; ATP2B; SERCA2; ATP2B; SERCA2; SR Ca(2+)-ATPase 2 |
|---|
| Gene, Accession # | ATP2A2, Gene ID: 488, NCBI: NP_001672.1, UniProt: P16615 |
|---|
| Catalog # | MBS178291 |
|---|
| Price | |
|---|
| Order / More Info | ATP2A2 Antibody from MYBIOSOURCE INC. |
|---|
| Product Specific References | 1. Ahn, W., Lee, M. G., Kim, K. H., Muallem, S. Multiple effects of SERCA2b mutations associated with Darier's disease. J. Biol. Chem. 278: 20795-20801, 2003. 2. Berk, D. R., Taube, J. M., Bruckner, A. L., Lane, A. T. A sporadic patient with acrokeratosis verruciformis of Hopf and a novel ATP2A2 mutation. (Letter) Brit. J. Derm. 163: 653-654, 2010. 3. Chao, S.-C., Yang, M.-H., Lee, J. Y.-Y. Mutation analysis of the ATP2A2 gene in Taiwanese patients with Darier's disease. Brit. J. Derm. 146: 958- |
|---|
| 产品资料 |
|
|