| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | ATP2A3 |
|---|
| Clone | n/a |
|---|
| Host Species | n/a |
|---|
| Reactive Species | mouse, rat predicted to work with: human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot (WB), Immunohistochemistry (IHC) Paraffin |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Anti-ATP2A3 Antibody |
|---|
| Immunogen | A synthetic peptide corresponding to a sequence at the N-terminus of human ATP2A3(1-30aa MEAAHLLPAADVLRHFSVTAEGGLSPAQVT), different from the related mouse sequence by five amino acids, and from the related rat sequence by six amino acids.Ig Type: Rabbit IgG |
|---|
| Other Names | sarcoplasmic/endoplasmic reticulum calcium ATPase 3 isoform a; Sarcoplasmic/endoplasmic reticulum calcium ATPase 3; sarcoplasmic/endoplasmic reticulum calcium ATPase 3; ATPase sarcoplasmic/endoplasmic reticulum Ca2+ transporting 3; Calcium pump 3, ATP2A3; ATP2A3; SERCA3; SERCA3; SR Ca(2+)-ATPase 3 |
|---|
| Gene, Accession # | ATP2A3, Gene ID: 489, NCBI: NP_005164.2, UniProt: Q93084 |
|---|
| Catalog # | MBS177877 |
|---|
| Price | |
|---|
| Order / More Info | ATP2A3 Antibody from MYBIOSOURCE INC. |
|---|
| Product Specific References | 1. Dode L, Wuytack F, Kools PF, Baba-Aissa F, Raeymaekers L, Brike F, van de Ven WJ, Casteels R (Nov 1996). 2. Gelebart, P., Kovacs, T., Brouland, J.-P., van Gorp, R., Grossmann, J., Rivard, N., Panis, Y., Martin, V., Bredoux, R., Enouf, J., Papp, B. Expression of endomembrane calcium pumps in colon and gastric cancer cells: induction of SERCA3 expression during differentiation. J. Biol. Chem. 277: 26310-26320, 2002. |
|---|
| 产品资料 |
|
|