| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | ELAVL4 |
|---|
| Clone | n/a |
|---|
| Host Species | n/a |
|---|
| Reactive Species | human, mouse, rat |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot (WB), Immunohistochemistry (IHC) Paraffin |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Anti-ELAVL4 Antibody |
|---|
| Immunogen | A synthetic peptide corresponding to a sequence at the N-terminus of human ELAVL4 (8-45aa MEPQVSNGPTSNTSNGPSSNNRNCPSPMQTGATTDDSK), different from the related mouse and rat sequences by one amino acid.Ig Type: Rabbit IgG |
|---|
| Other Names | ELAV-like protein 4 isoform 2; ELAV-like protein 4; ELAV-like protein 4; ELAV like neuron-specific RNA binding protein 4; Hu-antigen D; HuD; Paraneoplastic encephalomyelitis antigen HuD, ELAVL4; ELAVL4; HUD; PNEM; HUD; PNEM; HuD |
|---|
| Gene, Accession # | ELAVL4, Gene ID: 1996, NCBI: NP_001138246.1, UniProt: P26378 |
|---|
| Catalog # | MBS178337 |
|---|
| Price | |
|---|
| Order / More Info | ELAVL4 Antibody from MYBIOSOURCE INC. |
|---|
| Product Specific References | 1. Entrez Gene: ELAVL4 ELAV (embryonic lethal, abnormal vision, Drosophila)-like 4 (Hu antigen D). 2. Muresu R, Baldini A, Gress T, Posner JB, Furneaux HM, Siniscalco M (Dec 1993). Mapping of the gene coding for a paraneoplastic encephalomyelitis antigen (HuD) to human chromosome site 1p34. Cytogenet Cell Genet 65(3): 177-8. 3. Nora Perrone-Bizzozero and Federico Bolognani (2002). Role of HuD and other RNA-binding proteins in neural development and plasticity. J Neurosci Res 68 (2): 121-12 |
|---|
| 产品资料 |
|
|