| Edit |   |
|---|
| Antigenic Specificity | MOGAT1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 0.05 mg |
|---|
| Concentration | 1 mg/ml |
|---|
| Applications | Western Blot (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | MOGAT1 antibody. Specificity: MOGAT1 antibody was raised against the C terminal of MOGAT1 |
|---|
| Immunogen | MOGAT1 antibody was raised using the C terminal of MOGAT1 corresponding to a region with amino acids PIPVRQTLNPTQEQIEELHQTYMEELRKLFEEHKGKYGIPEHETLVLK |
|---|
| Other Names | Mogat1 protein; 2-acylglycerol O-acyltransferase 1; 2-acylglycerol O-acyltransferase 1; monoacylglycerol O-acyltransferase 1; Acyl-CoA:monoacylglycerol acyltransferase 1; MGAT1; Diacylglycerol acyltransferase 2-like protein 1; Monoacylglycerol O-acyltransferase 1, Mogat1; Mogat1; mDC2; MGAT1; Dgat2l; Dgat2l1; 0610030A14Rik; 1110064N14Rik; WI1-2612I11.1; Dgat2l1; MGAT1 |
|---|
| Gene, Accession # | MOGAT1, Gene ID: 68393, NCBI: AAI06136.1 |
|---|
| Catalog # | MBS839560 |
|---|
| Price | |
|---|
| Order / More Info | MOGAT1 Antibody from MYBIOSOURCE INC. |
|---|
| Product Specific References | n/a |
|---|