| Edit |   |
|---|
| Antigenic Specificity | MPV17L |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 0.05 mg |
|---|
| Concentration | 1 mg/ml |
|---|
| Applications | Western Blot (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | MPV17L antibody. Specificity: MPV17L antibody was raised against the N terminal of MPV17L |
|---|
| Immunogen | MPV17L antibody was raised using the N terminal of MPV17L corresponding to a region with amino acids MAGWWPALSRAARRHPWPTNVLLYGSLVSAGDALQQRLQGREANWRQTRR |
|---|
| Other Names | mpv17-like protein isoform 4; Mpv17-like protein; mpv17-like protein; Mpv17 transgene, kidney disease mutant-like, Mpv17l; Mpv17l; M-LP; M-LP |
|---|
| Gene, Accession # | MPV17L, Gene ID: 93734, NCBI: NP_001276496.1 |
|---|
| Catalog # | MBS5302193 |
|---|
| Price | |
|---|
| Order / More Info | MPV17L Antibody from MYBIOSOURCE INC. |
|---|
| Product Specific References | n/a |
|---|