| Edit |   |
|---|
| Antigenic Specificity | RNF121 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 0.05 mg |
|---|
| Concentration | 1 mg/ml |
|---|
| Applications | Western Blot (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | RNF121 antibody. Specificity: RNF121 antibody was raised against the middle region of RNF121 |
|---|
| Immunogen | RNF121 antibody was raised using the middle region of RNF121 corresponding to a region with amino acids GMPTKHLSDSVCAVCGQQIFVDVSEEGIIENTYRLSCNHVFHEFCIRGWC |
|---|
| Other Names | RNF121; RING finger protein 121, RNF121 |
|---|
| Gene, Accession # | RNF121, NCBI: CAG33579.1, UniProt: Q9H920 |
|---|
| Catalog # | MBS5300918 |
|---|
| Price | |
|---|
| Order / More Info | RNF121 Antibody from MYBIOSOURCE INC. |
|---|
| Product Specific References | n/a |
|---|