| Edit |   |
|---|
| Antigenic Specificity | RNF186 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 0.05 mg |
|---|
| Concentration | 1 mg/ml |
|---|
| Applications | Western Blot (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | RNF186 antibody. Specificity: RNF186 antibody was raised against the N terminal of RNF186 |
|---|
| Immunogen | RNF186 antibody was raised using the N terminal of RNF186 corresponding to a region with amino acids MACTKTLQQSQPISAGATTTTTAVAPAGGHSGSTECDLECLVCREPYSCP |
|---|
| Other Names | RING finger protein 186; RING finger protein 186; RING finger protein 186; ring finger protein 186, RNF186; RNF186 |
|---|
| Gene, Accession # | RNF186, Gene ID: 54546, NCBI: NP_061935.1 |
|---|
| Catalog # | MBS839133 |
|---|
| Price | |
|---|
| Order / More Info | RNF186 Antibody from MYBIOSOURCE INC. |
|---|
| Product Specific References | n/a |
|---|