| Edit |   |
|---|
| Antigenic Specificity | PROM1/Cd133 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse, rat |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 mg |
|---|
| Concentration | Add 0.2ml of distilled water will yield a concentration of 500ug/ml. |
|---|
| Applications | Western Blot (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Anti-PROM1/Cd133 Picoband Antibody. Reactivity: Human, Mouse, Rat No cross reactivity with other proteins. |
|---|
| Immunogen | A synthetic peptide corresponding to a sequence at the C-terminus of human PROM1 (808-841aa ALIFAVKLAKYYRRMDSEDVYDDVETIPMKNMEN), different from the related mouse sequence by six amino acids.Subcellular Localization: Apical cell membrane; Multi- pass membrane protein. Cell projection, microvillus me |
|---|
| Other Names | prominin-1 isoform 2; Prominin-1; prominin-1; prominin 1; Antigen AC133; Prominin-like protein 1; CD_antigen: CD133, PROM1; PROM1; RP41; AC133; CD133; MCDR2; STGD4; CORD12; PROML1; MSTP061; PROML1 |
|---|
| Gene, Accession # | PROM1, Gene ID: 8842, NCBI: NP_001139319.1, UniProt: O43490 |
|---|
| Catalog # | MBS1750712 |
|---|
| Price | |
|---|
| Order / More Info | PROM1/Cd133 Antibody from MYBIOSOURCE INC. |
|---|
| Product Specific References | n/a |
|---|