| Edit |   |
|---|
| Antigenic Specificity | UNQ1887 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 0.05 mg |
|---|
| Concentration | 1 mg/ml |
|---|
| Applications | Western Blot (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | UNQ1887 antibody. Specificity: UNQ1887 antibody was raised against the middle region of UNQ1887 |
|---|
| Immunogen | UNQ1887 antibody was raised using the middle region of UNQ1887 corresponding to a region with amino acids VMVKVATQPADNPLDVLSRKLHLGPNVGRDVPRLSLPGKLVFPSSTGSHF |
|---|
| Other Names | UNQ1887; UNQ1887; DKFZp586C1324; MGC126676; Signal Peptide Peptidase 3; IMP2; UNQ 1887; PSL4; SPPL3; PRO4332; UNQ-1887; MGC90402; MGC126674; UNQ1887; MDHV1887, |
|---|
| Gene, Accession # | UNQ1887 |
|---|
| Catalog # | MBS5300299 |
|---|
| Price | |
|---|
| Order / More Info | UNQ1887 Antibody from MYBIOSOURCE INC. |
|---|
| Product Specific References | n/a |
|---|