| Edit |   |
|---|
| Antigenic Specificity | FKSG24 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 0.05 mg |
|---|
| Concentration | 1 mg/ml |
|---|
| Applications | Western Blot (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | FKSG24 antibody. Specificity: FKSG24 antibody was raised against the N terminal of FKSG24 |
|---|
| Immunogen | FKSG24 antibody was raised using the N terminal of FKSG24 corresponding to a region with amino acids PFLHYWYLSLDRLFPASGLRGFPNVLKKVLVDQLVASPLLGVWYFLGLGC |
|---|
| Other Names | FKSG24; Mpv17-like protein 2; mpv17-like protein 2; MPV17 mitochondrial membrane protein-like 2, MPV17L2; MPV17L2; FKSG24; FKSG24 |
|---|
| Gene, Accession # | FKSG24, Gene ID: 84769, NCBI: AAL30173.1 |
|---|
| Catalog # | MBS5302490 |
|---|
| Price | |
|---|
| Order / More Info | FKSG24 Antibody from MYBIOSOURCE INC. |
|---|
| Product Specific References | n/a |
|---|