| Edit |   |
|---|
| Antigenic Specificity | Lyn |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse, rat |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 mg |
|---|
| Concentration | Add 0.2ml of distilled water will yield a concentration of 500ug/ml. |
|---|
| Applications | Immunohistochemistry (IHC), Western Blot (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Anti-Lyn Picoband Antibody. Reactivity: Human, Mouse, Rat No cross reactivity with other proteins. |
|---|
| Immunogen | A synthetic peptide corresponding to a sequence at the C-terminus of human Lyn (470-501aa DELYDIMKMCWKEKAEERPTFDYLQSVLDDFY), identical to the related mouse sequence, and different from the related rat sequence by one amino acid.Subcellular Localization: Cell membrane. Nucleus. Cytoplasm. Cytoplasm, |
|---|
| Other Names | tyrosine-protein kinase Lyn isoform B; Tyrosine-protein kinase Lyn; tyrosine-protein kinase Lyn; LYN proto-oncogene, Src family tyrosine kinase; Lck/Yes-related novel protein tyrosine kinase; V-yes-1 Yamaguchi sarcoma viral related oncogene homolog; p53Lyn; p56Lyn, LYN; LYN; JTK8; p53Lyn; p56Lyn; JTK8 |
|---|
| Gene, Accession # | Lyn, Gene ID: 4067, NCBI: NP_001104567.1, UniProt: P07948 |
|---|
| Catalog # | MBS1750642 |
|---|
| Price | |
|---|
| Order / More Info | Lyn Antibody from MYBIOSOURCE INC. |
|---|
| Product Specific References | n/a |
|---|