| Edit |   |
| Antigenic Specificity | LYPD5 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 0.05 mg |
| Concentration | 1 mg/ml |
| Applications | Western Blot (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | LYPD5 antibody. Specificity: LYPD5 antibody was raised against the N terminal of LYPD5 |
| Immunogen | LYPD5 antibody was raised using the N terminal of LYPD5 corresponding to a region with amino acids WTGPPAGQTQSNADALPPDYSVVRGCTTDKCNAHLMTHDALPNLSQAPDP |
| Other Names | LYPD5; LYPD5; LYPD 5; Ly6/Plaur Domain Containing 5; FLJ30469; PRO4356; LYPD-5; LYPD5, |
| Gene, Accession # | LYPD5 |
| Catalog # | MBS5301462 |
| Price | |
| Order / More Info | LYPD5 Antibody from MYBIOSOURCE INC. |
| Product Specific References | n/a |