| Edit |   |
| Antigenic Specificity | CTA-126B4.3 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 0.05 mg |
| Concentration | 1 mg/ml |
| Applications | Western Blot (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | CTA-126B4.3 antibody. Specificity: CTA-126B4.3 antibody was raised against the N terminal of CTA-126B4.3 |
| Immunogen | CTA-126B4.3 antibody was raised using the N terminal of CTA-126B4.3 corresponding to a region with amino acids NVPPYCTEESLSRLLSTCGLVQSVELQEKPDLAESPKESRSKFFHPKPVP |
| Other Names | CTA-126B4.3; CTA-126B4.3; CTA-B4.3-126; MGC150423; Cgi-96 Protein; CTA-126B4.3; CGI-96; CTA-B4.3 126; MGC150422; BK126B4.3, |
| Gene, Accession # | CTA-126B4.3 |
| Catalog # | MBS5300827 |
| Price | |
| Order / More Info | CTA-126B4.3 Antibody from MYBIOSOURCE INC. |
| Product Specific References | n/a |