| Edit |   |
|---|
| Antigenic Specificity | PPP6R1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 0.05 mg |
|---|
| Concentration | 1 mg/ml |
|---|
| Applications | Western Blot (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | PPP6R1 antibody. Specificity: PPP6R1 antibody was raised against the N terminal of PPP6R1 |
|---|
| Immunogen | PPP6R1 antibody was raised using the N terminal of PPP6R1 corresponding to a region with amino acids MFWKFDLHTSSHLDTLLEREDLSLPELLDEEDVLQECKVVNRKLLDFLLQ |
|---|
| Other Names | PPP6R1; PPP6R1; PP6R1; MGC142003; KIAA1115; MGC138185; PPP 6; PPP-6; PPP6; SAP190; Protein Phosphatase 6 Regulatory Subunit 1, |
|---|
| Gene, Accession # | PPP6R1 |
|---|
| Catalog # | MBS5301303 |
|---|
| Price | |
|---|
| Order / More Info | PPP6R1 Antibody from MYBIOSOURCE INC. |
|---|
| Product Specific References | n/a |
|---|