| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | PPP1R12A |
|---|
| Clone | n/a |
|---|
| Host Species | n/a |
|---|
| Reactive Species | human, mouse |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot (WB), Immunohistochemistry (IHC) Paraffin |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Anti-PPP1R12A Antibody |
|---|
| Immunogen | A synthetic peptide corresponding to a sequence at the N-terminus of human PPP1R12A (1-40aa MKMADAKQKRNEQLKRWIGSETDLEPPVVKRQKTKVKFDD), identical to the related mouse and rat sequences.Ig Type: Rabbit IgG |
|---|
| Other Names | protein phosphatase 1 regulatory subunit 12A isoform a; Protein phosphatase 1 regulatory subunit 12A; protein phosphatase 1 regulatory subunit 12A; protein phosphatase 1 regulatory subunit 12A; Myosin phosphatase-targeting subunit 1; Myosin phosphatase target subunit 1; Protein phosphatase myosin-binding subunit, PPP1R12A; PPP1R12A; MBS; M130; MYPT1; MBS; MYPT1; Myosin phosphatase target subunit 1 |
|---|
| Gene, Accession # | PPP1R12A, Gene ID: 4659, NCBI: NP_001137357.1, UniProt: O14974 |
|---|
| Catalog # | MBS177838 |
|---|
| Price | |
|---|
| Order / More Info | PPP1R12A Antibody from MYBIOSOURCE INC. |
|---|
| Product Specific References | 1. Kimura, K., Ito, M., Amano, M., Chihara, K., Fukata, Y., Nakafuku, M., Yamamori, B., Feng, J., Nakano, T., Okawa, K., Iwamatsu, A., Kaibuchi, K. Regulation of myosin phosphatase by Rho and Rho-associated kinase (Rho-kinase). Science 273: 245-248, 1996. 2. Takahashi, N., Ito, M., Tanaka, J., Nakano, T., Kaibuchi, K., Odai, H., Takemura, K. Localization of the gene coding for myosin phosphatase, target subunit 1 (MYPT1) to human chromosome 12q15-q21. Genomics 44: 150-152, 1997. |
|---|
| 产品资料 |
|
|