| Edit |   |
|---|
| Antigenic Specificity | PAPPA2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 0.05 mg |
|---|
| Concentration | 1 mg/ml |
|---|
| Applications | Western Blot (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | PAPPA2 antibody. Specificity: PAPPA2 antibody was raised against the middle region of PAPPA2 |
|---|
| Immunogen | PAPPA2 antibody was raised using the middle region of PAPPA2 corresponding to a region with amino acids ALPQSHFQHSSQHSSGEEEATDLVLTASFEPVNTEWVPFRDEKYPRLEVL |
|---|
| Other Names | pappalysin-2 isoform 1; Pappalysin-2; pappalysin-2; pappalysin 2; Pregnancy-associated plasma protein A2; PAPP-A2; Pregnancy-associated plasma protein E1; PAPP-E, PAPPA2; PAPPA2; PAPPE; PLAC3; PAPP-E; PAPP-A2; PLAC3; PAPP-A2; PAPP-E |
|---|
| Gene, Accession # | PAPPA2, Gene ID: 60676, NCBI: NP_064714.2 |
|---|
| Catalog # | MBS5300669 |
|---|
| Price | |
|---|
| Order / More Info | PAPPA2 Antibody from MYBIOSOURCE INC. |
|---|
| Product Specific References | n/a |
|---|