| Edit |   |
|---|
| Antigenic Specificity | PAR2 |
|---|
| Clone | n/a |
|---|
| Host Species | n/a |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Anti-PAR2 Antibody |
|---|
| Immunogen | A synthetic peptide corresponding to a sequence at the C-terminus of human PAR2 (349-383aa HDFRDHAKNALLCRSVRTVKQMQVSLTSKKHSRKS), different from the related mouse sequence by eight amino acids, and from the related rat sequence by seven amino acids.Ig Type: Rabbit IgG |
|---|
| Other Names | proteinase-activated receptor 2; Proteinase-activated receptor 2; proteinase-activated receptor 2; F2R like trypsin receptor 1; Coagulation factor II receptor-like 1; G-protein coupled receptor 11; Thrombin receptor-like 1, F2RL1; F2RL1; PAR2; GPR11; GPR11; PAR2; PAR-2 |
|---|
| Gene, Accession # | PAR2, Gene ID: 2150, NCBI: NP_005233.3, UniProt: P55085 |
|---|
| Catalog # | MBS177710 |
|---|
| Price | |
|---|
| Order / More Info | PAR2 Antibody from MYBIOSOURCE INC. |
|---|
| Product Specific References | 1. Kawabata A (2004). PAR-2: structure, function and relevance to human diseases of the gastric mucosa. Expert Reviews in Molecular Medicine 4(16): 1-17. 2. Lee SE, Jeong SK, Lee SH (November 2010). Protease and protease-activated receptor-2 signaling in the pathogenesis of atopic dermatitis. Yonsei Med. J. 51 (6): 808-22. |
|---|