| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | SLC22A2 |
|---|
| Clone | n/a |
|---|
| Host Species | n/a |
|---|
| Reactive Species | mouse, rat predicted to work with: human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot (WB), Immunohistochemistry (IHC) Paraffin |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Anti-SLC22A2 Antibody |
|---|
| Immunogen | A synthetic peptide corresponding to a sequence in the middle region of human SLC22A2 (524-555aa ETIEEAENMQRPRKNKEKMIYLQVQKLDIPLN), different from the related mouse sequence by five amino acids, and from the related rat sequence by seven amino acids.Ig Type: Rabbit IgG |
|---|
| Other Names | solute carrier family 22 member 2; Solute carrier family 22 member 2; solute carrier family 22 member 2; solute carrier family 22 member 2; Organic cation transporter 2; hOCT2, SLC22A2; SLC22A2; OCT2; OCT2; hOCT2 |
|---|
| Gene, Accession # | SLC22A2, Gene ID: 6582, NCBI: NP_003049.2, UniProt: O15244 |
|---|
| Catalog # | MBS178391 |
|---|
| Price | |
|---|
| Order / More Info | SLC22A2 Antibody from MYBIOSOURCE INC. |
|---|
| Product Specific References | 1. Entrez Gene: SLC22A2 solute carrier family 22 (organic cation transporter), member 2. 2. Koehler, M. R., Wissinger, B., Gorboulev, V., Koepsell, H., Schmid, M. The two human organic cation transporter genes SLC22A1 and SLC22A2 are located on chromosome 6q26. Cytogenet. Cell Genet. 79: 198-200, 1997. |
|---|
| 产品资料 |
|
|