| Edit |   |
|---|
| Antigenic Specificity | RP11-217H1.1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 0.05 mg |
|---|
| Concentration | 1 mg/ml |
|---|
| Applications | Western Blot (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | RP11-217H1.1 antibody. Specificity: RP11-217H1.1 antibody was raised against the N terminal Of Rp11-217H1.1 |
|---|
| Immunogen | RP11-217H1.1 antibody was raised using the N terminal Of Rp11-217H1.1 corresponding to a region with amino acids ARWRFWCVSVTMVVALLIVCDVPSASAQRKKEMVLSEKVSQLMEWTNKRP |
|---|
| Other Names | RP11-217H1.1; RP11-217H1.1; MGC64926; bA217H1.1; RP-217H1.1-11; PRO0756; RP11-217H1.1; RP-217H1.1 11; MAGT1; FLJ14726; DKFZp564K142, |
|---|
| Gene, Accession # | RP11-217H1.1 |
|---|
| Catalog # | MBS5302004 |
|---|
| Price | |
|---|
| Order / More Info | RP11-217H1.1 Antibody from MYBIOSOURCE INC. |
|---|
| Product Specific References | n/a |
|---|