| Edit |   |
|---|
| Antigenic Specificity | NBEAL1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 0.05 mg |
|---|
| Concentration | 1 mg/ml |
|---|
| Applications | Western Blot (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | NBEAL1 antibody. Specificity: NBEAL1 antibody was raised against the N terminal of NBEAL1 |
|---|
| Immunogen | NBEAL1 antibody was raised using the N terminal of NBEAL1 corresponding to a region with amino acids KDNDKNMSTEDTKKNSDEKTDEEKITSFASANVSSDQWSLEDRHSLDSNT |
|---|
| Other Names | neurobeachin-like protein 1; Neurobeachin-like protein 1; neurobeachin-like protein 1; neurobeachin-like 1; Amyotrophic lateral sclerosis 2 chromosomal region candidate gene 16 protein; Amyotrophic lateral sclerosis 2 chromosomal region candidate gene 17 protein, NBEAL1; NBEAL1; ALS2CR16; ALS2CR17; A530083I02Rik; ALS2CR16; ALS2CR17 |
|---|
| Gene, Accession # | NBEAL1, Gene ID: 65065, NCBI: NP_001107604.1 |
|---|
| Catalog # | MBS5301148 |
|---|
| Price | |
|---|
| Order / More Info | NBEAL1 Antibody from MYBIOSOURCE INC. |
|---|
| Product Specific References | n/a |
|---|