| Edit |   |
|---|
| Antigenic Specificity | TRPM3 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 0.05 mg |
|---|
| Concentration | 1 mg/ml |
|---|
| Applications | Western Blot (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | TRPM3 antibody. Specificity: TRPM3 antibody was raised against the N terminal of TRPM3 |
|---|
| Immunogen | TRPM3 antibody was raised using the N terminal of TRPM3 corresponding to a region with amino acids RPYQTMSNPMSKLTVLNSMHSHFILADNGTTGKYGAEVKLRRQLEKHISL |
|---|
| Other Names | TRPM3; TRPM3; Transient Receptor Potential Cation Channel Subfamily M Member 3; TRPM-3; TRPM 3; TRPM3, |
|---|
| Gene, Accession # | TRPM3 |
|---|
| Catalog # | MBS839593 |
|---|
| Price | |
|---|
| Order / More Info | TRPM3 Antibody from MYBIOSOURCE INC. |
|---|
| Product Specific References | n/a |
|---|