| Edit |   |
|---|
| Antigenic Specificity | CX36 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | Protein A purified |
|---|
| Size | 0.1 mg |
|---|
| Concentration | 1 mg/ml |
|---|
| Applications | Western Blot (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | CX36 antibody. Specificity: CX36 antibody was raised against the middle region of Cx36 |
|---|
| Immunogen | CX36 antibody was raised using the middle region of Cx36 corresponding to a region with amino acids NTSKETEPDCLEVKELTPHPSGLRTASKSKLRRQEGISRFYIIQVVFRNA |
|---|
| Other Names | connexin-36; Gap junction delta-2 protein; gap junction delta-2 protein; gap junction protein, delta 2, 36kDa; Connexin-36; Cx36; Gap junction alpha-9 protein, GJD2; GJD2; CX36; GJA9; GJA9; Cx36 |
|---|
| Gene, Accession # | CX36, Gene ID: 57369, NCBI: EAW92315.1 |
|---|
| Catalog # | MBS5301752 |
|---|
| Price | |
|---|
| Order / More Info | CX36 Antibody from MYBIOSOURCE INC. |
|---|
| Product Specific References | n/a |
|---|