| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Kv1.4 |
|---|
| Clone | n/a |
|---|
| Host Species | n/a |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot (WB), Immunohistochemistry (IHC) Paraffin |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Anti-Kv1.4 Antibody |
|---|
| Immunogen | A synthetic peptide corresponding to a sequence at the C-terminus of human Kv1.4 (609-647aa SEYLEMEEGVKESLCAKEEKCQGKGDDSETDKNNCSNAK), different from the related mouse sequence by two amino acids, and from the related rat sequence by one amino acid.Ig Type: Rabbit IgG |
|---|
| Other Names | potassium voltage-gated channel subfamily A member 4; Potassium voltage-gated channel subfamily A member 4; potassium voltage-gated channel subfamily A member 4; potassium voltage-gated channel subfamily A member 4; HPCN2; Voltage-gated K(+) channel HuKII, KCNA4; KCNA4; HK1; HBK4; PCN2; HPCN2; HUKII; KCNA8; KV1.4; KCNA4L; KCNA4L |
|---|
| Gene, Accession # | Kv1.4, Gene ID: 3739, NCBI: NP_002224.1, UniProt: P22459 |
|---|
| Catalog # | MBS177914 |
|---|
| Price | |
|---|
| Order / More Info | Kv1.4 Antibody from MYBIOSOURCE INC. |
|---|
| Product Specific References | 1. Entrez Gene: KCNA4 potassium voltage-gated channel, shaker-related subfamily, member 4. 2. Gutman GA, Chandy KG, Grissmer S, Lazdunski M, McKinnon D, Pardo LA, Robertson GA, Rudy B, Sanguinetti MC, Stuhmer W, Wang X (Dec 2005). International Union of Pharmacology. LIII. Nomenclature and molecular relationships of voltage-gated potassium channels. Pharmacol Rev 57 (4): 473-508. 3. Philipson LH, Schaefer K, LaMendola J, Bell GI, Steiner DF (Feb 1991).Sequence of a human fetal skeletal musc |
|---|
| 产品资料 |
|
|