| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | 12 Lipoxygenase |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse, rat |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Anti-12 Lipoxygenase Antibody. Specificity: No cross reactivity with other proteins. |
|---|
| Immunogen | A synthetic peptide corresponding to a sequence at the N-terminus of human 12 Lipoxygenase (186-231aa ALKRVYTLLSSWNCLEDFDQIFWGQKSALAEKVRQCWQDDELFSYQ), different from the related mouse sequence by six amino acids, and from the related rat sequence by seven amino acids. |
|---|
| Other Names | arachidonate 12-lipoxygenase, 12S-type; Arachidonate 12-lipoxygenase, 12S-type; arachidonate 12-lipoxygenase, 12S-type; arachidonate 12-lipoxygenase, 12S type; Lipoxin synthase 12-LO (EC:3.3.2.-); Platelet-type lipoxygenase 12, ALOX12; ALOX12; LOG12; 12-LOX; 12S-LOX; 12LO; LOG12; 12S-LOX; 12S-lipoxygenase |
|---|
| Gene, Accession # | ALOX12, Gene ID: 239, NCBI: NP_000688.2, UniProt: P18054 |
|---|
| Catalog # | MBS178664 |
|---|
| Price | |
|---|
| Order / More Info | 12 Lipoxygenase Antibody from MYBIOSOURCE INC. |
|---|
| Product Specific References | 1. Funk, C. D., Furci, L., FitzGerald, G. A.Molecular cloning, primary structure, and expression of the human platelet/erythroleukemia cell 12-lipoxygenase.Proc. Nat. Acad. Sci. 87: 5638-5642, 1990. 2. Natarajan, R., Esworthy, R., Bai, W., Gu, J.-L., Wilczynski, S., Nadler, J.Increased 12-lipoxygenase expression in breast cancer tissues and cells. Regulation by epidermal growth factor.J. Clin. Endocr. Metab. 82: 1790-1798, 1997. 3. Yoshimoto, T., Arakawa, T., Hada, T., Yamamoto, S., Takaha |
|---|
| 产品资料 |
|
|