| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | GRK6 |
|---|
| Clone | n/a |
|---|
| Host Species | n/a |
|---|
| Reactive Species | human, rat |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Anti-GRK6 Antibody |
|---|
| Immunogen | A synthetic peptide corresponding to a sequence at the C-terminus of human GRK6 (382-417aa QSPFQQRKKKIKREEVERLVKEVPEEYSERFSPQAR), different from the related mouse sequence by four amino acids, and from the related rat sequence by three amino acids.Ig Type: Rabbit IgG |
|---|
| Other Names | G protein-coupled receptor kinase 6 isoform C; G protein-coupled receptor kinase 6; G protein-coupled receptor kinase 6; G protein-coupled receptor kinase 6; G protein-coupled receptor kinase GRK6, GRK6; GRK6; GPRK6; GPRK6 |
|---|
| Gene, Accession # | GRK6, Gene ID: 2870, NCBI: NP_001004105.1, UniProt: P43250 |
|---|
| Catalog # | MBS178349 |
|---|
| Price | |
|---|
| Order / More Info | GRK6 Antibody from MYBIOSOURCE INC. |
|---|
| Product Specific References | 1. Entrez Gene: GRK6 G protein-coupled receptor kinase 6. 2. Haribabu B, Snyderman R (Nov 1993). Identification of additional members of human G-protein-coupled receptor kinase multigene family. Proc Natl Acad Sci U S A 90 (20): 9398-402. 3. Raehal KM, Schmid CL, Medvedev IO, Gainetdinov RR, Premont RT, Bohn LM (June 2009). Morphine-Induced Physiological and Behavioral Responses in Mice Lacking G Protein-Coupled Receptor Kinase 6. Drug and Alcohol Dependence 104 (3): 187-96. |
|---|
| 产品资料 |
|
|