| Edit |   |
|---|
| Antigenic Specificity | NT5DC2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 0.05 mg |
|---|
| Concentration | 1 mg/ml |
|---|
| Applications | Western Blot (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | NT5DC2 antibody. Specificity: NT5DC2 antibody was raised against the N terminal of NT5DC2 |
|---|
| Immunogen | NT5DC2 antibody was raised using the N terminal of NT5DC2 corresponding to a region with amino acids IRKYDYNPSFAIRGLHYDIQKSLLMKIDAFHYVQLGTAYRGLQPVPDEEV |
|---|
| Other Names | NT5DC2 protein; 5'-nucleotidase domain-containing protein 2; 5'-nucleotidase domain-containing protein 2; 5'-nucleotidase domain containing 2, NT5DC2; NT5DC2 |
|---|
| Gene, Accession # | NT5DC2, Gene ID: 64943, NCBI: AAH14550.1 |
|---|
| Catalog # | MBS5302676 |
|---|
| Price | |
|---|
| Order / More Info | NT5DC2 Antibody from MYBIOSOURCE INC. |
|---|
| Product Specific References | n/a |
|---|