| Edit |   |
| Antigenic Specificity | DKFZP761C169 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 0.05 mg |
| Concentration | 1 mg/ml |
| Applications | Western Blot (WB), Immunohistochemistry (IHC) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | DKFZP761C169 antibody. Specificity: DKFZP761C169 antibody was raised against the N terminal Of Dkfzp761C169 |
| Immunogen | DKFZP761C169 antibody was raised using the N terminal Of Dkfzp761C169 corresponding to a region with amino acids RKEKNGWRTHGRNGTENINHRGGYHGGSSRSRSSIFHAGKSQGLHENNIP |
| Other Names | DKFZP761C169; DKFZP761C169, |
| Gene, Accession # | DKFZP761C169 |
| Catalog # | MBS5302672 |
| Price | |
| Order / More Info | DKFZP761C169 Antibody from MYBIOSOURCE INC. |
| Product Specific References | n/a |