| Edit |   |
|---|
| Antigenic Specificity | DKFZP564O0523 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 0.05 mg |
|---|
| Concentration | 1 mg/ml |
|---|
| Applications | Western Blot (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | DKFZP564O0523 antibody. Specificity: DKFZP564O0523 antibody was raised against the C terminal of DKFZP564O0523 |
|---|
| Immunogen | DKFZP564O0523 antibody was raised using the C terminal of DKFZP564O0523 corresponding to a region with amino acids FLQTNPTGNEIMIGPLLPDISKVDMHDDSLNTTANLIRHKLKEVISSVPK |
|---|
| Other Names | DKFZP564O0523; DKFZP564O0523 protein; DKFZP564O0523 protein, DKFZP564O0523 |
|---|
| Gene, Accession # | DKFZP564O0523, NCBI: CAG38580.1, UniProt: Q6FI77 |
|---|
| Catalog # | MBS838945 |
|---|
| Price | |
|---|
| Order / More Info | DKFZP564O0523 Antibody from MYBIOSOURCE INC. |
|---|
| Product Specific References | n/a |
|---|