| Edit |   |
|---|
| Antigenic Specificity | RABL4 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 0.05 mg |
|---|
| Concentration | 1 mg/ml |
|---|
| Applications | Western Blot (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | RABL4 antibody. Specificity: RABL4 antibody was raised against the C terminal of RABL4 |
|---|
| Immunogen | RABL4 antibody was raised using the C terminal of RABL4 corresponding to a region with amino acids RAWALGQGLECFETSVKEMENFEAPFHCLAKQFHQLYREKVEVFRALA |
|---|
| Other Names | RABL4; RABL4; RAYL; RABL 4; RABL4; Rab Member Of Ras Oncogene Family-Like 4; RABL-4, |
|---|
| Gene, Accession # | RABL4 |
|---|
| Catalog # | MBS5301700 |
|---|
| Price | |
|---|
| Order / More Info | RABL4 Antibody from MYBIOSOURCE INC. |
|---|
| Product Specific References | n/a |
|---|