| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | MMP12 |
|---|
| Clone | n/a |
|---|
| Host Species | n/a |
|---|
| Reactive Species | mouse |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot (WB), ELISA (EIA) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Anti-MMP12 Antibody |
|---|
| Immunogen | A synthetic peptide corresponding to a sequence at the C-terminus of mouse MMP12 (432-466aa KIDAVLYFKRHYYIFQGAYQLEYDPLFRRVTKTLK), different from the related human sequence by thirteen amino acids, and from the related rat sequence by three amino acids.Ig Type: Rabbit IgG |
|---|
| Other Names | macrophage metalloelastase isoform 2; Macrophage metalloelastase; macrophage metalloelastase; matrix metallopeptidase 12; Matrix metalloproteinase-12; MMP-12, Mmp12; Mmp12; MME; Mmel; AV378681; Mme; Mmel; MME; MMP-12 |
|---|
| Gene, Accession # | MMP12, Gene ID: 17381, NCBI: NP_001307005.1, UniProt: P34960 |
|---|
| Catalog # | MBS178278 |
|---|
| Price | |
|---|
| Order / More Info | MMP12 Antibody from MYBIOSOURCE INC. |
|---|
| Product Specific References | 1. Houghton, A. M., Hartzell, W. O., Robbins, C. S., Gomis-Ruth, F. X., Shapiro, S. D.Macrophage elastase kills bacteria within murine macrophages. Nature 460: 637-641, 2009. 2. Joos, L., He, J.-Q., Shepherdson, M. B., Connett, J. E., Anthonisen, N. R., Pare, P. D., Sandford, A. J. The role of matrix metalloproteinase polymorphisms in the rate of decline in lung function. Hum. Molec. Genet. 11: 569-576, 2002. Note: Erratum: Hum. Molec. Genet. 12: 803-804, 2003. 3. Wu, L., Tanimoto, A., Murata, Y |
|---|
| 产品资料 |
|
|