| Edit |   |
|---|
| Antigenic Specificity | MAK |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 mg |
|---|
| Concentration | Add 0.2ml of distilled water will yield a concentration of 500ug/ml. |
|---|
| Applications | Western Blot (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Anti-MAK Picoband Antibody. Reactivity: Human No cross reactivity with other proteins. |
|---|
| Immunogen | A synthetic peptide corresponding to a sequence at the C-terminus of human MAK (588-623aa RTYNPTAKNLNIVNRAQPIPSVHGRTDWVAKYGGHR), different from the related mouse and rat sequences by two amino acids.Subcellular Localization: Nucleus. Cytoplasm, cytoskeleton, microtubule organizing center, centrosom |
|---|
| Other Names | serine/threonine-protein kinase MAK isoform 2; Serine/threonine-protein kinase MAK; serine/threonine-protein kinase MAK; male germ cell associated kinase; Male germ cell-associated kinase, MAK; MAK; RP62 |
|---|
| Gene, Accession # | MAK, Gene ID: 4117, NCBI: NP_001229314.1, UniProt: P20794 |
|---|
| Catalog # | MBS1750391 |
|---|
| Price | |
|---|
| Order / More Info | MAK Antibody from MYBIOSOURCE INC. |
|---|
| Product Specific References | n/a |
|---|