| Edit |   |
|---|
| Antigenic Specificity | RP11-78J21.1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | Protein A purified |
|---|
| Size | 0.1 mg |
|---|
| Concentration | 1 mg/ml |
|---|
| Applications | Western Blot (WB), Immunohistochemistry (IHC) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | RP11-78J21.1 antibody. Specificity: RP11-78J21.1 antibody was raised against the N terminal of RP11-78J21.1 |
|---|
| Immunogen | RP11-78J21.1 antibody was raised using the N terminal of RP11-78J21.1 corresponding to a region with amino acids MSKSASPKEPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPN |
|---|
| Other Names | RP11-78J21.1; RP11-78J21.1; RP11-78J21.1; Heterogeneous Nuclear Ribonucleoprotein A1-Like; RP-78J21.1-11; RP-78J21.1 11, |
|---|
| Gene, Accession # | RP11-78J21.1 |
|---|
| Catalog # | MBS5300280 |
|---|
| Price | |
|---|
| Order / More Info | RP11-78J21.1 Antibody from MYBIOSOURCE INC. |
|---|
| Product Specific References | n/a |
|---|