| Edit |   |
|---|
| Antigenic Specificity | SPPL2B |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 0.05 mg |
|---|
| Concentration | 1 mg/ml |
|---|
| Applications | Western Blot (WB), Immunohistochemistry (IHC) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | SPPL2B antibody. Specificity: SPPL2B antibody was raised against the N terminal of SPPL2B |
|---|
| Immunogen | SPPL2B antibody was raised using the N terminal of SPPL2B corresponding to a region with amino acids VARGNCTFYEKVRLAQGSGARGLLIVSRERLVPPGGNKTQYDEIGIPVAL |
|---|
| Other Names | signal peptide peptidase-like 2B isoform 3; Signal peptide peptidase-like 2B; signal peptide peptidase-like 2B; signal peptide peptidase like 2B; Intramembrane protease 4; IMP-4; Presenilin homologous protein 4; PSH4; Presenilin-like protein 1, SPPL2B; SPPL2B; IMP4; PSH4; PSL1; IMP-4; IMP4; KIAA1532; PSL1; SPP-like 2B; SPPL2b; IMP-4; PSH4 |
|---|
| Gene, Accession # | SPPL2B, Gene ID: 56928, NCBI: NP_001070706.1 |
|---|
| Catalog # | MBS839114 |
|---|
| Price | |
|---|
| Order / More Info | SPPL2B Antibody from MYBIOSOURCE INC. |
|---|
| Product Specific References | n/a |
|---|