| Edit |   |
|---|
| Antigenic Specificity | TPCN1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 0.05 mg |
|---|
| Concentration | 1 mg/ml |
|---|
| Applications | Western Blot (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | TPCN1 antibody. Specificity: TPCN1 antibody was raised against the N terminal of TPCN1 |
|---|
| Immunogen | TPCN1 antibody was raised using the N terminal of TPCN1 corresponding to a region with amino acids YQEAAIYLQEGENNDKFFTHPKDAKALAAYLFAHNHLFYLMELATALLLL |
|---|
| Other Names | TPCN1 protein; Two pore calcium channel protein 1; two pore calcium channel protein 1; two pore segment channel 1; Voltage-dependent calcium channel protein TPC1, TPCN1; TPCN1; TPC1; KIAA1169; TPC1 |
|---|
| Gene, Accession # | TPCN1, Gene ID: 53373, NCBI: AAI42665.1 |
|---|
| Catalog # | MBS5300733 |
|---|
| Price | |
|---|
| Order / More Info | TPCN1 Antibody from MYBIOSOURCE INC. |
|---|
| Product Specific References | n/a |
|---|