| Edit |   |
|---|
| Antigenic Specificity | ETS1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 mg |
|---|
| Concentration | Add 0.2ml of distilled water will yield a concentration of 500ug/ml. |
|---|
| Applications | Western Blot (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Anti-ETS1 Picoband Antibody. Reactivity: Human, Mouse No cross reactivity with other proteins. |
|---|
| Immunogen | A synthetic peptide corresponding to a sequence at the N-terminus of human ETS1 (67-98aa KDPRQWTETHVRDWVMWAVNEFSLKGVDFQKF), identical to the related mouse and rat sequences.Subcellular Localization: Cytoplasm. Nucleus. Delocalizes from nucleus to cytoplasm when coexpressed with isoform Ets-1 p27.T |
|---|
| Other Names | protein C-ets-1 isoform 1; Protein C-ets-1; protein C-ets-1; ETS proto-oncogene 1, transcription factor; p54, ETS1; ETS1; p54; ETS-1; EWSR2; c-ets-1; EWSR2 |
|---|
| Gene, Accession # | ETS1, Gene ID: 2113, NCBI: NP_001137292.1, UniProt: P14921 |
|---|
| Catalog # | MBS1750518 |
|---|
| Price | |
|---|
| Order / More Info | ETS1 Antibody from MYBIOSOURCE INC. |
|---|
| Product Specific References | n/a |
|---|