| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Argonaute 4 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, rat |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Anti-Argonaute 4 Antibody. Reactivity: Human, Rat No cross reactivity with other proteins. |
|---|
| Immunogen | A synthetic peptide corresponding to a sequence at the N-terminus of human Argonaute 4 (114-153aa KDQTFKVSVQWVSVVSLQLLLEALAGHLNEVPDDSVQALD), identical to the related mouse sequence. |
|---|
| Other Names | protein argonaute-4; Protein argonaute-4; protein argonaute-4; argonaute 4, RISC catalytic component; Argonaute RISC catalytic component 4; Eukaryotic translation initiation factor 2C 4, AGO4; AGO4; EIF2C4; EIF2C4; KIAA1567; Argonaute4; hAgo4; eIF-2C 4; eIF2C 4 |
|---|
| Gene, Accession # | AGO4, Gene ID: 192670, NCBI: NP_060099.2, UniProt: Q9HCK5 |
|---|
| Catalog # | MBS178479 |
|---|
| Price | |
|---|
| Order / More Info | Argonaute 4 Antibody from MYBIOSOURCE INC. |
|---|
| Product Specific References | 1. Carmell, M. A., Xuan, Z., Zhang, M. Q., Hannon, G. J. The argonaute family: tentacles that reach into RNAi, developmental control, stem cell maintenance, and tumorigenesis. Genes Dev. 16: 2733-2742, 2002. 2. Nagase, T., Kikuno, R., Nakayama, M., Hirosawa, M., Ohara, O. Prediction of the coding sequences of unidentified human genes. XVIII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro. DNA Res. 7: 273-281, 2000. |
|---|
| 产品资料 |
|
|