| Edit |   |
| Antigenic Specificity | Cardiotrophin 1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 0.05 mg |
| Concentration | 1 mg/ml |
| Applications | Western Blot (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Cardiotrophin 1 antibody. Specificity: Cardiotrophin 1 antibody was raised against the N terminal of CTF1 |
| Immunogen | Cardiotrophin 1 antibody was raised using the N terminal of CTF1 corresponding to a region with amino acids MSRREGSLEDPQTDSSVSLLPHLEAKIRQTHSLAHLLTKYAEQLLQEYVQ |
| Other Names | cardiotrophin-1 isoform 1; Cardiotrophin-1; cardiotrophin-1; cardiotrophin 1, CTF1; CTF1; CT1; CT-1; CT-1 |
| Gene, Accession # | Gene ID: 1489, NCBI: NP_001321.1 |
| Catalog # | MBS5302309 |
| Price | |
| Order / More Info | Cardiotrophin 1 Antibody from MYBIOSOURCE INC. |
| Product Specific References | n/a |