| Edit |   |
|---|
| Antigenic Specificity | PIGQ |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 0.05 mg |
|---|
| Concentration | 1 mg/ml |
|---|
| Applications | Western Blot (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | PIGQ antibody. Specificity: PIGQ antibody was raised against the N terminal of PIGQ |
|---|
| Immunogen | PIGQ antibody was raised using the N terminal of PIGQ corresponding to a region with amino acids PTVLPDRQAGATTASTGGLAAVFDTVARSEVLFRSDRFDEGPVRLSHWQS |
|---|
| Other Names | PIGQ; PIGQ; GPI1; c407A10.1; MGC12693; Phosphatidylinositol Glycan Anchor Biosynthesis Class Q; hGPI1, |
|---|
| Gene, Accession # | PIGQ |
|---|
| Catalog # | MBS5300314 |
|---|
| Price | |
|---|
| Order / More Info | PIGQ Antibody from MYBIOSOURCE INC. |
|---|
| Product Specific References | n/a |
|---|